RDHE2 (SDR16C5) Rabbit Polyclonal Antibody TA340321 from OriGene Technologies | Biocompare.com

Supplier Images

RDHE2 (SDR16C5) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RDHE2 (SDR16C5) Rabbit Polyclonal Antibody

The RDHE2 (SDR16C5) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to SDR16C5. This antibody recognizes Human antigen. The RDHE2 (SDR16C5) Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-SDR16C5 Antibody

Product Specs
ItemRDHE2 (SDR16C5) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA340321
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetSDR16C5
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SDR16C5 antibody: synthetic peptide directed towards the middle region of human SDR16C5. Synthetic peptide located within the following region: AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
NCBI Full Gene Nameshort chain dehydrogenase/reductase family 16C member 5
NCBI Gene AliasesEPHD-2, RDH#2, RDHE2, retSDR2, RDH-E2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!